PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00018.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 196aa    MW: 22792 Da    PI: 5.3427
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00018.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.82.4e-1386136555
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                              +++rr+++NRe+ArrsR RK+  ++eL   v  L + N+ L+++l++ ++ 
  Rsa1.0_00018.1_g00010.1  86 RKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNRVSES 136
                              79*******************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-1482146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.1E-1184136No hitNo description
PROSITE profilePS5021710.11784136IPR004827Basic-leucine zipper domain
PfamPF001705.8E-1186138IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.86E-1286135No hitNo description
CDDcd147022.17E-1887138No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MNTIPAELTG YFQYVSPEIY NNQTPSMDSQ YFNMPLSPTS SSSYYINGLM SNNNYYSSSS  60
NVQDLTTSNN STSDDDHQQS VAIDERKQRR MISNRESARR SRMRKQRHLD ELWSQVIRLR  120
TDNHCLIDKL NRVSESHQLA LKENAKLKEE TSNLRQLISE IKSNNEDNNN FLRELEDSIS  180
NSRSDSDLMG RDFELC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198105RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0271340.0AC027134.4 Arabidopsis thaliana chromosome I BAC F13B4 genomic sequence, complete sequence.
GenBankAF3324300.0AF332430.1 Arabidopsis thaliana clone C00105 (e) putative bZIP transcription factor (At1g13600) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF21F230.0AC027656.4 Sequence of BAC F21F23 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013691364.11e-117PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC27e-33BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A078I5Z11e-117A0A078I5Z1_BRANA; BnaC01g30400D protein
STRINGBra019715.1-P1e-110(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.11e-111basic leucine-zipper 58